51.7.20 DSEQCTRL

Name: DSEQCTRL
Offset: 0x38
Reset: 0x00000000
Property: PAC Write-Protection

Bit 3130292827262524 
 AUTOSTART        
Access R/W 
Reset 0 
Bit 2322212019181716 
          
Access  
Reset  
Bit 15141312111098 
        OFFSETCORR 
Access R/W 
Reset 0 
Bit 76543210 
 GAINCORRWINUTWINLTSAMPCTRLAVGCTRLREFCTRLCTRLBINPUTCTRL 
Access R/WR/WR/WR/WR/WR/WR/WR/W 
Reset 00000000 

Bit 31 – AUTOSTART ADC Auto-Start Conversion

ValueDescription
0 ADC conversion starts when a DMA sequence is complete and a start software or event trigger is received.
1 ADC conversion automatically starts when a DMA sequence is complete. This setting is ignored if the convertion start by event is enabled (EVCTRL.STARTEI = 1).

Bit 8 – OFFSETCORR Offset Correction

ValueDescription
0 DMA update of the Offset Correction register is disabled.
1 DMA update of the Offset Correction register is enabled.

Bit 7 – GAINCORR Gain Correction

ValueDescription
0 DMA update of the Gain Correction register is disabled.
1 DMA update of the Gain Correction register is enabled.

Bit 6 – WINUT Window Monitor Upper Threshold

ValueDescription
0 DMA update of the Window Monitor Upper Threshold register is disabled.
1 DMA update of the Window Monitor Upper Threshold register is enabled.

Bit 5 – WINLT Window Monitor Lower Threshold

ValueDescription
0 DMA update of the Window Monitor Lower Threshold register is disabled.
1 DMA update of the Window Monitor Lower Threshold register is enabled.

Bit 4 – SAMPCTRL Sampling Time Control

ValueDescription
0 DMA update of the Sampling Time Control register is disabled.
1 DMA update of the Sampling Time Control register is enabled.

Bit 3 – AVGCTRL Average Control

Note: AVGCTRL must be set to '1' if AVGCTRL.SAMPLENUM>1.
ValueDescription
0 DMA update of the Average Control register is disabled.
1 DMA update of the Average Control register is enabled.

Bit 2 – REFCTRL Reference Control

ValueDescription
0 DMA update of the Reference Control register is disabled.
1 DMA update of the Reference Control register is enabled.

Bit 1 – CTRLB Control B

ValueDescription
0 DMA update of the Control B register is disabled.
1 DMA update of the Control B register is enabled.

Bit 0 – INPUTCTRL Input Control

ValueDescription
0 DMA update of the Input Control register is disabled.
1 DMA update of the Input Control register is enabled.